Human Recombinant ASGR2

Leverandør: OriGene

TP313607 TP313607M
ORIGTP313607EA 14175 NOK
ORIGTP313607 ORIGTP313607M
Human Recombinant ASGR2
Proteiner

This gene encodes a subunit of the asialoglycoprotein receptor. This receptor is a transmembrane protein that plays a critical role in serum glycoprotein homeostasis by mediating the endocytosis and lysosomal degradation of glycoproteins with exposed terminal galactose or N-acetylgalactosamine residues.


  • Expression host: HEK293T
  • Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7,3, 10% glycerol


Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.


The asialoglycoprotein receptor may facilitate hepatic infection by multiple viruses including hepatitis B, and is also a target for liver-specific drug delivery. The asialoglycoprotein receptor is a hetero-oligomeric protein composed of major and minor subunits, which are encoded by different genes. The protein encoded by this gene is the less abundant minor subunit. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.


NB: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.

Bestill nå

SPESIFIKASJONER

Protein/peptide name ASGR2
Environmentally Preferable
Protein synonyms ASGP-R2|HL-2|asialoglycoprotein receptor 2|ASGPR2|CLEC4H2|HBXBP
Protein/peptide type Recombinant
Arter Human
Kilde
Sekvens MAKDFQDIQQLSSEENDHPFHQGEGPGTRRLNPRRGNPFLKGPPPAQPLAQRLCSMVCFSLLALSFNILL
LVVICVTGSQSEGHRGAQLQAELRSLKEAFSNFSSSTLTEVQAISTHGGSVGDKITSLGAKLEKQQQDLK
ADHDALLFHLKHFPVDLRFVACQMELLHSNGSQRTCCPVNWVEHQGSCYWFSHSGKAWAEAEKYCQLENA
HLVVINSWEEQKFIVQHTNPFNTWIGLTDSDGSWKWVDGTDYRHNYKNWAVTQPDNWHGHELGGSEDCVE
VQPDGRWNDDFCLQVYRWVCEKRRNATGEVA

myc-FLAG tag
UniProtKB P07307
Renhet >80% as determined by SDS-PAGE and Coomassie blue staining
Konsentrasjon >0,05 µg/µl as determined by microplate BCA method
Molekylvekt 35 kDa
Lagringsforhold Store at −80 °C
Tag sekvens C-Myc/DDK

Learn more

About VWR

Avantor is a vertically integrated, global supplier of discovery-to-delivery solutions for...

Les mer About VWR